PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P12740_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 228aa    MW: 25875.6 Da    PI: 4.57
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P12740_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.6e-1849102356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+++++ eq+++Le+ Fe ++++  e++ +LA++l L+ rqV vWFqNrRa++k
  GSMUA_Achr7P12740_001  49 KKRRLSVEQVRALEKNFEVDNKLEPERKVRLAQELVLQPRQVAVWFQNRRARWK 102
                            556899***********************************************9 PP

2HD-ZIP_I/II1314.5e-4249140293
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrls eqv++LE++Fe ++kLeperKv+la+eL lqprqvavWFqnrRAR+ktkqlE+dy+aLk++ydal+ + ++L++++e+L +
  GSMUA_Achr7P12740_001  49 KKRRLSVEQVRALEKNFEVDNKLEPERKVRLAQELVLQPRQVAVWFQNRRARWKTKQLEHDYAALKASYDALRLDYDALRRDNESLIA 136
                            9**************************************************************************************9 PP

            HD-ZIP_I/II  90 elke 93 
                            e+ke
  GSMUA_Achr7P12740_001 137 EIKE 140
                            9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-1937106IPR009057Homeodomain-like
PROSITE profilePS5007117.26544104IPR001356Homeobox domain
SMARTSM003891.5E-1647108IPR001356Homeobox domain
CDDcd000867.42E-1649105No hitNo description
PfamPF000462.6E-1549102IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-1951111IPR009057Homeodomain-like
PROSITE patternPS00027079102IPR017970Homeobox, conserved site
PfamPF021833.3E-18104145IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MKRSLSYSDH PSMPAGEERG MFQSFMDGLE DDDGVEQEEM CNGGERGSKK RRLSVEQVRA  60
LEKNFEVDNK LEPERKVRLA QELVLQPRQV AVWFQNRRAR WKTKQLEHDY AALKASYDAL  120
RLDYDALRRD NESLIAEIKE LKTKLTASDK EEAMTSKAEE KAAAPEEPLA KDGSSDSDSS  180
AVLLNDQDSP RGRSSSASTE ELLGGDEPCG SSFFSYDQTP FPSWYYWT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196104RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409283.11e-143PREDICTED: homeobox-leucine zipper protein HOX4-like isoform X1
SwissprotQ6K4985e-59HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH375e-59HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLM0TH121e-168M0TH12_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P12740_0011e-167(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.19e-51homeobox protein 5